Lineage for d1wmya_ (1wmy A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442630Protein Lectin CEL-I [111262] (1 species)
  7. 1442631Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
    Uniprot Q7M462
  8. 1442636Domain d1wmya_: 1wmy A: [109420]
    complexed with ca, mpd

Details for d1wmya_

PDB Entry: 1wmy (more details), 2 Å

PDB Description: Crystal Structure of C-type Lectin CEL-I from Cucumaria echinata
PDB Compounds: (A:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-type

SCOPe Domain Sequences for d1wmya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmya_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

SCOPe Domain Coordinates for d1wmya_:

Click to download the PDB-style file with coordinates for d1wmya_.
(The format of our PDB-style files is described here.)

Timeline for d1wmya_: