Lineage for d1wmsa_ (1wms A:)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Rab9a [110537] (3 species) Species Human (Homo sapiens) [TaxId:9606] [110539] (1 PDB entry)
Uniprot P51151 2-175 # 100% sequence identity do the dog protein (Uniprot P24408 2-175)
Domain d1wmsa_: 1wms A: [109414]
complexed with gdp
Details for d1wmsa_
PDB Entry: 1wms (more details), 1.25 Å
PDB Description: High resolution crystal structure of human Rab9 GTPase: a novel antiviral drug target
PDB Compounds: (A:) Ras-related protein Rab-9ASCOPe Domain Sequences for d1wmsa_:
Sequence, based on SEQRES records: (download)
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}
agksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiw
dtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvi
lgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat
Sequence, based on observed residues (ATOM records): (download)
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}
agksslfkvillgdggvgksslmnryvtnkfdttigveflnkdlevdghfvtmqiwdtag
qerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgnk
idiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat
SCOPe Domain Coordinates for d1wmsa_:
Click to download the PDB-style file with coordinates for d1wmsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wmsa_:
- d1wmsa_ first appeared in SCOP 1.69
- d1wmsa_ appears in SCOPe 2.01
- d1wmsa_ appears in SCOPe 2.03
- d1wmsa_ appears in the current release, SCOPe 2.08
View in 3D
