Lineage for d1wkia_ (1wki A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647277Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 1647342Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 1647343Protein Ribosomal protein L16p [117889] (4 species)
  7. 1647381Species Thermotoga maritima [TaxId:2336] [117890] (1 PDB entry)
    Uniprot P60489
  8. 1647382Domain d1wkia_: 1wki A: [114725]
    Structural genomics target

Details for d1wkia_

PDB Entry: 1wki (more details)

PDB Description: solution structure of ribosomal protein L16 from thermus thermophilus HB8
PDB Compounds: (A:) LSU ribosomal protein L16P

SCOPe Domain Sequences for d1wkia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkia_ d.41.4.2 (A:) Ribosomal protein L16p {Thermotoga maritima [TaxId: 2336]}
mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
aghklpiktkivrrdaydeaq

SCOPe Domain Coordinates for d1wkia_:

Click to download the PDB-style file with coordinates for d1wkia_.
(The format of our PDB-style files is described here.)

Timeline for d1wkia_: