Lineage for d1wg5a_ (1wg5 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908490Protein Heterogeneous nuclear ribonucleoprotein H' [117955] (1 species)
  7. 1908491Species Human (Homo sapiens) [TaxId:9606] [117956] (2 PDB entries)
    Uniprot P55795 103-193; 280-369
  8. 1908492Domain d1wg5a_: 1wg5 A: [114602]
    Structural genomics target; 1st RBD

Details for d1wg5a_

PDB Entry: 1wg5 (more details)

PDB Description: solution structure of the first rrm domain in heterogeneous nuclear ribonucleoprotein h
PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein H

SCOPe Domain Sequences for d1wg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}
gssgssgnspdtandgfvrlrglpfgcskeeivqffsgleivpngmtlpvdfqgrstgea
fvqfasqeiaekalkkhkerighryieifkssraevrtsgpssg

SCOPe Domain Coordinates for d1wg5a_:

Click to download the PDB-style file with coordinates for d1wg5a_.
(The format of our PDB-style files is described here.)

Timeline for d1wg5a_: