Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein RNA-binding protein Raly (Autoantigen p542) [117959] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117960] (1 PDB entry) Uniprot Q9UKM9 1-97 |
Domain d1wf1a_: 1wf1 A: [114572] Structural genomics target |
PDB Entry: 1wf1 (more details)
SCOPe Domain Sequences for d1wf1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf1a_ d.58.7.1 (A:) RNA-binding protein Raly (Autoantigen p542) {Human (Homo sapiens) [TaxId: 9606]} gssgssgmslklqasnvtnkndpksinsrvfignlntalvkksdvetifskygrvagcsv hkgyafvqysnerharaavlgengrvlagqtldinmagepkpdrsgpssg
Timeline for d1wf1a_: