Lineage for d1wexa_ (1wex A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908494Protein Heterogeneous nuclear ribonucleoprotein L-like [117951] (1 species)
  7. 1908495Species Mouse (Mus musculus) [TaxId:10090] [117952] (1 PDB entry)
    Uniprot Q921F4 116-207
  8. 1908496Domain d1wexa_: 1wex A: [114568]
    Structural genomics target

Details for d1wexa_

PDB Entry: 1wex (more details)

PDB Description: solution structure of rrm domain in protein bab28521
PDB Compounds: (A:) hypothetical protein (riken cdna 2810036l13)

SCOPe Domain Sequences for d1wexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgshhkvsvspvvhvrglcesvveadlvealekfgticyvmmmpfkrqalvefen
idsakecvtfaadvpvyiagqqaffnystskritrpgnsgpssg

SCOPe Domain Coordinates for d1wexa_:

Click to download the PDB-style file with coordinates for d1wexa_.
(The format of our PDB-style files is described here.)

Timeline for d1wexa_: