Lineage for d1wepa_ (1wep A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967224Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1967225Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1967248Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 1967274Protein PHD finger protein 8 [118336] (1 species)
  7. 1967275Species Mouse (Mus musculus) [TaxId:10090] [118337] (1 PDB entry)
    Uniprot Q80TJ7 1-66
  8. 1967276Domain d1wepa_: 1wep A: [114562]
    Structural genomics target
    complexed with zn

Details for d1wepa_

PDB Entry: 1wep (more details)

PDB Description: solution structure of phd domain in phf8
PDB Compounds: (A:) phf8

SCOPe Domain Sequences for d1wepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmalvpvyclcrqpynvnhfmiecglcqdwfhgscvgieeenavdidiyhcpdc
eavfgpsimknwhsgpssg

SCOPe Domain Coordinates for d1wepa_:

Click to download the PDB-style file with coordinates for d1wepa_.
(The format of our PDB-style files is described here.)

Timeline for d1wepa_: