Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (9 proteins) |
Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species) |
Species Pseudomonas fragi [TaxId:296] [110757] (4 PDB entries) Uniprot P28790 |
Domain d1wdkc2: 1wdk C:264-391 [109259] Other proteins in same PDB: d1wdka1, d1wdka2, d1wdka3, d1wdka4, d1wdkb1, d1wdkb2, d1wdkb3, d1wdkb4 complexed with aco, hg, n8e, nad, zn |
PDB Entry: 1wdk (more details), 2.5 Å
SCOPe Domain Sequences for d1wdkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg iatvferv
Timeline for d1wdkc2: