Lineage for d1wdkc2 (1wdk C:264-391)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881083Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1881443Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species)
  7. 1881444Species Pseudomonas fragi [TaxId:296] [110757] (4 PDB entries)
    Uniprot P28790
  8. 1881446Domain d1wdkc2: 1wdk C:264-391 [109259]
    Other proteins in same PDB: d1wdka1, d1wdka2, d1wdka3, d1wdka4, d1wdkb1, d1wdkb2, d1wdkb3, d1wdkb4
    complexed with aco, hg, n8e, nad, zn

Details for d1wdkc2

PDB Entry: 1wdk (more details), 2.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native2)
PDB Compounds: (C:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d1wdkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]}
gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl
kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg
iatvferv

SCOPe Domain Coordinates for d1wdkc2:

Click to download the PDB-style file with coordinates for d1wdkc2.
(The format of our PDB-style files is described here.)

Timeline for d1wdkc2: