Lineage for d1wdde1 (1wdd E:151-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838608Species Rice (Oryza sativa) [TaxId:4530] [117390] (5 PDB entries)
    Uniprot P12089
  8. 2838610Domain d1wdde1: 1wdd E:151-475 [114530]
    Other proteins in same PDB: d1wdda2, d1wdde2, d1wdds_, d1wddw_
    complexed with cap, gol, mg

Details for d1wdde1

PDB Entry: 1wdd (more details), 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1wdde1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdde1 c.1.14.1 (E:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
pphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkddenvnsqp
fmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivmhdyl
tggftantslahycrdnglllhihramhavidrqknhgmhfrvlakalrmsggdhihagt
vvgklegeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmpal
teifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiirsack
wspelaaaceiwkaikfefepvdkl

SCOPe Domain Coordinates for d1wdde1:

Click to download the PDB-style file with coordinates for d1wdde1.
(The format of our PDB-style files is described here.)

Timeline for d1wdde1:

2838610
d1wdde1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1wdde2