Lineage for d1wcga1 (1wcg A:3-464)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) 
Protein Thioglucosidase [141786] (1 species) Species Cabbage aphid (Brevicoryne brassicae) [TaxId:69196] [141787] (1 PDB entry)
Uniprot Q95X01 3-464
Domain d1wcga1: 1wcg A:3-464 [120888]
complexed with gol
Details for d1wcga1
PDB Entry: 1wcg (more details), 1.1 Å
PDB Description: aphid myrosinase
PDB Compounds: (A:) thioglucosidaseSCOPe Domain Sequences for d1wcga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]}
ykfpkdfmfgtstasyqieggwnedgkgeniwdrlvhtspevikdgtngdiacdsyhkyk
edvaiikdlnlkfyrfsiswariapsgvmnslepkgiayynnlinelikndiiplvtmyh
wdlpqylqdlggwvnpimsdyfkeyarvlftyfgdrvkwwitfnepiavckgysikayap
nlnlkttghylaghtqliahgkayrlyeemfkptqngkisisisgvffmpknaesdddie
taeranqfergwfghpvykgdyppimkkwvdqkskeeglpwsklpkftkdeikllkgtad
fyalnhyssrlvtfgsdpnpnfnpdasyvtsvdeawlkpnetpyiipvpeglrklliwlk
neygnpqllitengygddgqlddfekisylknylnatlqamyedkcnvigytvwslldnf
ewfygysihfglvkidfndpqrtrtkresytyfknvvstgkp
SCOPe Domain Coordinates for d1wcga1:
Click to download the PDB-style file with coordinates for d1wcga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wcga1:
- d1wcga1 first appeared in SCOP 1.73
- d1wcga1 appears in SCOPe 2.01
- d1wcga1 appears in SCOPe 2.03
- d1wcga1 appears in the current release, SCOPe 2.08
View in 3D
