Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.0: automated matches [191399] (1 protein) not a true family |
Protein automated matches [190523] (11 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225097] (6 PDB entries) |
Domain d1wcfa_: 1wcf A: [202990] automated match to d4ecpb_ complexed with k, po4 |
PDB Entry: 1wcf (more details), 1.54 Å
SCOPe Domain Sequences for d1wcfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcfa_ b.40.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} hmqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldal vllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldai khffvhykdlepgkfvkaadwvdraeaeaevqrsverfkagt
Timeline for d1wcfa_: