Lineage for d1w7xl_ (1w7x L:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701750Protein automated matches [190092] (1 species)
    not a true protein
  7. 1701751Species Human (Homo sapiens) [TaxId:9606] [187310] (66 PDB entries)
  8. 1701767Domain d1w7xl_: 1w7x L: [120700]
    Other proteins in same PDB: d1w7xh_
    automated match to d1klil_
    complexed with 413, ca, gol, so4

Details for d1w7xl_

PDB Entry: 1w7x (more details), 1.8 Å

PDB Description: factor7 - 413 complex
PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d1w7xl_:

Sequence, based on SEQRES records: (download)

>d1w7xl_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Sequence, based on observed residues (ATOM records): (download)

>d1w7xl_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d1w7xl_:

Click to download the PDB-style file with coordinates for d1w7xl_.
(The format of our PDB-style files is described here.)

Timeline for d1w7xl_:

1701767
d1w7xl_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1w7xh_