Details for d1w2bd_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Compounds: (D:) 50s ribosomal protein l5p hmal5, hl13, ribosomal protein l5

SCOPe Domain Sequences for d1w2bd_:

Sequence, based on SEQRES records: (download)

>d1w2bd_ i.1.1.2 (D:) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvevs

Sequence, based on observed residues (ATOM records): (download)

>d1w2bd_ i.1.1.2 (D:) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvevs

SCOPe Domain Coordinates for d1w2bd_:

Timeline for d1w2bd_:

• d1w2bd_ first appeared in SCOP 1.69
  
• d1w2bd_ appears in SCOPe 2.03
  
• d1w2bd_ appears in SCOPe 2.05
  
• d1w2bd_ appears in the current release, SCOPe 2.08
  

Thumbnails for d1w2bd_:

d1w2bd_ (click for larger image) View in 3D

d1w2bd_ in context of chain View in 3D

d1w2bd_ in context of PDB d1w2b1_ in context of PDB d1w2b2_ in context of PDB d1w2b5_ in context of PDB d1w2ba_ in context of PDB d1w2bb_ in context of PDB d1w2bc_ in context of PDB d1w2be_ in context of PDB d1w2bf_ in context of PDB d1w2bg_ in context of PDB d1w2bh_ in context of PDB d1w2bi_ in context of PDB d1w2bj_ in context of PDB d1w2bk_ in context of PDB d1w2bl_ in context of PDB d1w2bm_ in context of PDB d1w2bn_ in context of PDB d1w2bo_ in context of PDB d1w2bp_ in context of PDB d1w2br_ in context of PDB d1w2bs_ in context of PDB d1w2bt_ in context of PDB d1w2bu_ in context of PDB d1w2bv_ in context of PDB d1w2bw_ in context of PDB d1w2bx_ in context of PDB d1w2by_ in context of PDB d1w2bz_ in context of PDB View in 3D Domains from other chains: (mouse over for more information) d1w2b1_, d1w2b2_, d1w2b5_, d1w2ba_, d1w2bb_, d1w2bc_, d1w2be_, d1w2bf_, d1w2bg_, d1w2bh_, d1w2bi_, d1w2bj_, d1w2bk_, d1w2bl_, d1w2bm_, d1w2bn_, d1w2bo_, d1w2bp_, d1w2br_, d1w2bs_, d1w2bt_, d1w2bu_, d1w2bv_, d1w2bw_, d1w2bx_, d1w2by_, d1w2bz_