Lineage for d1w0ja3 (1w0j A:95-379)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126370Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2126431Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species)
  7. 2126450Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries)
    Uniprot P19483
  8. 2126457Domain d1w0ja3: 1w0j A:95-379 [108991]
    Other proteins in same PDB: d1w0ja1, d1w0ja2, d1w0jb1, d1w0jb2, d1w0jc1, d1w0jc2, d1w0jd1, d1w0jd2, d1w0jd3, d1w0je1, d1w0je2, d1w0je3, d1w0jf1, d1w0jf2, d1w0jf3, d1w0jg_
    complexed with adp, bef, gol, mg, po4

Details for d1w0ja3

PDB Entry: 1w0j (more details), 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain heart isoform, mitochondrial precursor

SCOPe Domain Sequences for d1w0ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ja3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d1w0ja3:

Click to download the PDB-style file with coordinates for d1w0ja3.
(The format of our PDB-style files is described here.)

Timeline for d1w0ja3: