Lineage for d1vpxe_ (1vpx E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1821734Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (3 species)
    forms helix-swapped pentamers
  7. 1821746Species Thermotoga maritima [TaxId:2336] [117379] (1 PDB entry)
    Uniprot Q9WYD1
  8. 1821751Domain d1vpxe_: 1vpx E: [113981]
    Structural genomics target
    complexed with gol, so4

Details for d1vpxe_

PDB Entry: 1vpx (more details), 2.4 Å

PDB Description: Crystal structure of Transaldolase (EC 2.2.1.2) (TM0295) from Thermotoga maritima at 2.40 A resolution
PDB Compounds: (E:) PROTEIN (Transaldolase (EC 2.2.1.2))

SCOPe Domain Sequences for d1vpxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpxe_ c.1.10.1 (E:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]}
hmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevv
sldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaa
kagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgv
divtmpfavleklfkhpmtdlgierfmedwkkylen

SCOPe Domain Coordinates for d1vpxe_:

Click to download the PDB-style file with coordinates for d1vpxe_.
(The format of our PDB-style files is described here.)

Timeline for d1vpxe_: