Lineage for d1vpla_ (1vpl A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596847Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1597053Protein Putative ABC transporter TM0544 [117548] (1 species)
  7. 1597054Species Thermotoga maritima [TaxId:2336] [117549] (1 PDB entry)
    Uniprot Q9WZ14
  8. 1597055Domain d1vpla_: 1vpl A: [113966]
    Structural genomics target
    complexed with so4

Details for d1vpla_

PDB Entry: 1vpl (more details), 2.1 Å

PDB Description: Crystal structure of ABC transporter ATP-binding protein (TM0544) from Thermotoga maritima at 2.10 A resolution
PDB Compounds: (A:) ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d1vpla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}
gavvvkdlrkrigkkeilkgisfeieegeifgligpngagktttlriistlikpssgivt
vfgknvveephevrklisylpeeagayrnmqgieylrfvagfyasssseieemveratei
aglgekikdrvstyskgmvrklliaralmvnprlaildeptsgldvlnarevrkilkqas
qegltilvsshnmleveflcdrialihngtivetgtveelkerykaqnieevfeevvk

SCOPe Domain Coordinates for d1vpla_:

Click to download the PDB-style file with coordinates for d1vpla_.
(The format of our PDB-style files is described here.)

Timeline for d1vpla_: