Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Putative ABC transporter TM0544 [117548] (1 species) |
Species Thermotoga maritima [TaxId:2336] [117549] (1 PDB entry) Uniprot Q9WZ14 |
Domain d1vpla_: 1vpl A: [113966] Structural genomics target complexed with so4 |
PDB Entry: 1vpl (more details), 2.1 Å
SCOPe Domain Sequences for d1vpla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} gavvvkdlrkrigkkeilkgisfeieegeifgligpngagktttlriistlikpssgivt vfgknvveephevrklisylpeeagayrnmqgieylrfvagfyasssseieemveratei aglgekikdrvstyskgmvrklliaralmvnprlaildeptsgldvlnarevrkilkqas qegltilvsshnmleveflcdrialihngtivetgtveelkerykaqnieevfeevvk
Timeline for d1vpla_: