Lineage for d1vp4a_ (1vp4 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.1: AAT-like [53384] (17 proteins) 
Protein Putative aminotransferase TM1131 [117691] (1 species) Species Thermotoga maritima [TaxId:2336] [117692] (1 PDB entry)
Uniprot Q9X0L5
Domain d1vp4a_: 1vp4 A: [113935]
Structural genomics target
complexed with edo, fmt, plp, unl
Details for d1vp4a_
PDB Entry: 1vp4 (more details), 1.82 Å
PDB Description: Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 A resolution
PDB Compounds: (A:) aminotransferase, putativeSCOPe Domain Sequences for d1vp4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]}
ihhhhhhmvvnlegkiskigqnmkssiireilkfaadkdaisfgggvpdpetfprkelae
iakeiiekeyhytlqysttegdpvlkqqilkllermygitgldednliftvgsqqaldli
gklflddesycvlddpaylgainafrqylanfvvvpleddgmdlnvlerklsefdkngki
kqvkfiyvvsnfhnpagvttslekrkalveiaekydlfiveddpygalryegetvdpifk
iggpervvllntfskvlapglrigmvagskefirkivqakqsadlcspaithrlaaryle
rydlleqlkptielyrrkrtvmlnaleeyfsdipgvkwvksegglfiwltlpegfdtwem
feyakrkkvfyvpgrvfkvydepspsmrlsfclppdekivegikrlrevvleygkekhll
SCOPe Domain Coordinates for d1vp4a_:
Click to download the PDB-style file with coordinates for d1vp4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vp4a_:
- d1vp4a_ first appeared in SCOP 1.71
- d1vp4a_ appears in SCOPe 2.04
- d1vp4a_ is called d1vp4a1 in SCOPe 2.06
- d1vp4a_ appears in the current release, SCOPe 2.08, called d1vp4a1
View in 3D
