Lineage for d1vm7a_ (1vm7 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.72: Ribokinase-like [53612] (3 superfamilies)
core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
potential superfamily: members of this fold have similar functions but different ATP-binding sitesSuperfamily c.72.1: Ribokinase-like [53613] (6 families) 
has extra strand located between strands 2 and 3Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
automatically mapped to Pfam PF00294
Protein Ribokinase [53615] (3 species) 
Species Thermotoga maritima [TaxId:2336] [110706] (1 PDB entry)
Uniprot Q9X055
Domain d1vm7a_: 1vm7 A: [108884]
Structural genomics target
Details for d1vm7a_
PDB Entry: 1vm7 (more details), 2.15 Å
PDB Description: Crystal structure of Ribokinase (TM0960) from Thermotoga maritima at 2.15 A resolution
PDB Compounds: (A:) ribokinaseSCOPe Domain Sequences for d1vm7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]}
mflvisvvgssnidivlkvdhftkpgetqkaiemnvfpggkganqavtvakigekgcrfv
tcignddysdllienyeklgitgyirvslptgrafievdktgqnriiifpganaelkkel
idwntlsesdilllqneipfettlecakrfngivifdpapaqgineeifqyldyltpnek
eiealskdffgefltvekaaekflelgvknvivklgdkgvllvnknekkhfptfkvkavd
ttaagdvfngafavalsegknpeeavifgtaaaaisvtrlgaqssipareeveaflknl
SCOPe Domain Coordinates for d1vm7a_:
Click to download the PDB-style file with coordinates for d1vm7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vm7a_:
- d1vm7a_ first appeared in SCOP 1.69
- d1vm7a_ appears in SCOPe 2.07
View in 3D
