Lineage for d1vlzb_ (1vlz B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) Protein CheY protein [52174] (6 species) Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
Uniprot P06143
Domain d1vlzb_: 1vlz B: [31049]
mutant
Details for d1vlzb_
PDB Entry: 1vlz (more details), 2.05 Å
PDB Description: uncoupled phosphorylation and activation in bacterial chemotaxis: the 2.1 angstrom structure of a threonine to isoleucine mutant at position 87 of chey
PDB Compounds: (B:) cheySCOPe Domain Sequences for d1vlzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlzb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
dkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpn
mdglellktiradgamsalpvlmviaeakkeniiaaaqagasgyvvkpftaatleeklnk
ifeklgm
SCOPe Domain Coordinates for d1vlzb_:
Click to download the PDB-style file with coordinates for d1vlzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vlzb_:
- d1vlzb_ first appeared (with stable ids) in SCOP 1.55
- d1vlzb_ appears in SCOPe 2.07
View in 3D
