Lineage for d1vina2 (1vin A:309-432)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495405Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1495418Protein Cyclin A [47956] (2 species)
  7. 1495419Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)
  8. 1495437Domain d1vina2: 1vin A:309-432 [18355]

Details for d1vina2

PDB Entry: 1vin (more details), 2 Å

PDB Description: bovine cyclin a3
PDB Compounds: (A:) cyclin a

SCOPe Domain Sequences for d1vina2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vina2 a.74.1.1 (A:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOPe Domain Coordinates for d1vina2:

Click to download the PDB-style file with coordinates for d1vina2.
(The format of our PDB-style files is described here.)

Timeline for d1vina2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vina1