Lineage for d1vina1 (1vin A:181-308)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (4 families) 
duplication: consists of two domains of this foldFamily a.74.1.1: Cyclin [47955] (9 proteins) 
Protein Cyclin A [47956] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries) 
Domain d1vina1: 1vin A:181-308 [18354]
Details for d1vina1
PDB Entry: 1vin (more details), 2 Å
PDB Description: bovine cyclin a3
PDB Compounds: (A:) cyclin aSCOPe Domain Sequences for d1vina1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vina1 a.74.1.1 (A:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vlafdlaa
SCOPe Domain Coordinates for d1vina1:
Click to download the PDB-style file with coordinates for d1vina1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vina1:
- d1vina1 first appeared (with stable ids) in SCOP 1.55, called d1vin_1
- d1vina1 appears in SCOPe 2.03
- d1vina1 appears in SCOPe 2.05
- d1vina1 appears in the current release, SCOPe 2.08
View in 3D
