Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Putative shikimate dehydrogenase YdiB [82305] (1 species) |
Species Escherichia coli [TaxId:562] [82306] (3 PDB entries) |
Domain d1vi2b1: 1vi2 B:107-287 [100728] Other proteins in same PDB: d1vi2a2, d1vi2b2 structural genomics complexed with nad, so4 |
PDB Entry: 1vi2 (more details), 2.1 Å
SCOPe Domain Sequences for d1vi2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi2b1 c.2.1.7 (B:107-287) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} dgtghiraikesgfdikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkala faqrvnentdcvvtvtdladqqafaealasadiltngtkvgmkpleneslvndisllhpg llvtecvynphmtkllqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgf g
Timeline for d1vi2b1: