Lineage for d1vi2b1 (1vi2 B:107-287)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
Protein Putative shikimate dehydrogenase YdiB [82305] (1 species) Species Escherichia coli [TaxId:562] [82306] (3 PDB entries) 
Domain d1vi2b1: 1vi2 B:107-287 [100728]
Other proteins in same PDB: d1vi2a2, d1vi2b2
structural genomics
complexed with nad, so4
Details for d1vi2b1
PDB Entry: 1vi2 (more details), 2.1 Å
PDB Description: Crystal structure of shikimate-5-dehydrogenase with NAD
PDB Compounds: (B:) Shikimate 5-dehydrogenase 2SCOPe Domain Sequences for d1vi2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi2b1 c.2.1.7 (B:107-287) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]}
dgtghiraikesgfdikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkala
faqrvnentdcvvtvtdladqqafaealasadiltngtkvgmkpleneslvndisllhpg
llvtecvynphmtkllqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgf
g
SCOPe Domain Coordinates for d1vi2b1:
Click to download the PDB-style file with coordinates for d1vi2b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vi2b1:
- d1vi2b1 first appeared in SCOP 1.67
- d1vi2b1 appears in SCOPe 2.02
- d1vi2b1 appears in SCOPe 2.04
- d1vi2b1 appears in the current release, SCOPe 2.08
View in 3D
