Lineage for d1vhya1 (1vhy A:3-73)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1564510Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1564511Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1564561Family b.122.1.2: YggJ N-terminal domain-like [89451] (3 proteins)
  6. 1564562Protein Hypothetical protein HI0303 [89452] (1 species)
  7. 1564563Species Haemophilus influenzae [TaxId:727] [89453] (2 PDB entries)
  8. 1564564Domain d1vhya1: 1vhy A:3-73 [100714]
    Other proteins in same PDB: d1vhya2, d1vhyb2
    structural genomics

Details for d1vhya1

PDB Entry: 1vhy (more details), 1.9 Å

PDB Description: crystal structure of haemophilus influenzae protein hi0303, pfam duf558
PDB Compounds: (A:) Hypothetical protein HI0303

SCOPe Domain Sequences for d1vhya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhya1 b.122.1.2 (A:3-73) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]}
ipriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkksv
kveilgrelad

SCOPe Domain Coordinates for d1vhya1:

Click to download the PDB-style file with coordinates for d1vhya1.
(The format of our PDB-style files is described here.)

Timeline for d1vhya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhya2