Lineage for d1vf5d1 (1vf5 D:46-179)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309649Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1309661Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species)
  7. 1309664Species Mastigocladus laminosus [TaxId:83541] [101666] (5 PDB entries)
  8. 1309667Domain d1vf5d1: 1vf5 D:46-179 [100583]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5d1

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (D:) Rieske iron-sulfur protein

SCOPe Domain Sequences for d1vf5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin
avcthlgcvvpwnaaenkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpw
tetdfrtgekpwwv

SCOPe Domain Coordinates for d1vf5d1:

Click to download the PDB-style file with coordinates for d1vf5d1.
(The format of our PDB-style files is described here.)

Timeline for d1vf5d1: