Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103499] (5 PDB entries) |
Domain d1vf5a_: 1vf5 A: [100578] Other proteins in same PDB: d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_ complexed with bcr, cla, fes, hem, opc, pl9, tds |
PDB Entry: 1vf5 (more details), 3 Å
SCOPe Domain Sequences for d1vf5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5a_ f.21.1.2 (A:) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp wliavfmllhflmirkqgisgp
Timeline for d1vf5a_: