Lineage for d1veta_ (1vet A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) 
alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helicesFamily d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
Pfam PF03259
Protein MEK binding partner 1, MP1 [111120] (2 species)
remote homolog that forms the characteristic complex structures with other members
Species Mouse (Mus musculus) [TaxId:10090] [111122] (2 PDB entries)
Uniprot O88653
Domain d1veta_: 1vet A: [108553]
Other proteins in same PDB: d1vetb_
Details for d1veta_
PDB Entry: 1vet (more details), 1.9 Å
PDB Description: Crystal Structure of p14/MP1 at 1.9 A resolution
PDB Compounds: (A:) Mitogen-activated protein kinase kinase 1 interacting protein 1SCOPe Domain Sequences for d1veta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veta_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Mouse (Mus musculus) [TaxId: 10090]}
addlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqgs
klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikvv
ev
SCOPe Domain Coordinates for d1veta_:
Click to download the PDB-style file with coordinates for d1veta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1veta_:
- d1veta_ first appeared in SCOP 1.69
- d1veta_ appears in SCOPe 2.07
View in 3D
