Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Novel antigen receptor 12Y-2 [110046] (1 species) |
Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [110047] (1 PDB entry) Uniprot Q6X1E6 # fragment |
Domain d1vesa_: 1ves A: [108551] |
PDB Entry: 1ves (more details), 2.18 Å
SCOPe Domain Sequences for d1vesa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn kgsksfslrisdlrvedsgtykcqafyslplgdynysllfrgekgagtaltvk
Timeline for d1vesa_: