Lineage for d1veia_ (1vei A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084505Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1084698Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. 1084708Domain d1veia_: 1vei A: [108531]
    complexed with fe, so4

Details for d1veia_

PDB Entry: 1vei (more details), 2.85 Å

PDB Description: Mycobacterium smegmatis Dps
PDB Compounds: (A:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1veia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veia_ a.25.1.1 (A:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaa

SCOPe Domain Coordinates for d1veia_:

Click to download the PDB-style file with coordinates for d1veia_.
(The format of our PDB-style files is described here.)

Timeline for d1veia_: