Lineage for d1ve3a1 (1ve3 A:2-227)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) 
Family c.66.1.43: CAC2371-like [117688] (3 proteins)
similar overall fold to the Glycine N-methyltransferase (53348) and mRNA cap (Guanine N-7) methyltransferase (102560) families
Protein Hypothetical protein PH0226 [142599] (1 species) Species Pyrococcus horikoshii [TaxId:53953] [142600] (1 PDB entry)
Uniprot O57965 2-227
Domain d1ve3a1: 1ve3 A:2-227 [120010]
complexed with sam
Details for d1ve3a1
PDB Entry: 1ve3 (more details), 2.1 Å
PDB Description: crystal structure of ph0226 protein from pyrococcus horikoshii ot3
PDB Compounds: (A:) hypothetical protein PH0226SCOPe Domain Sequences for d1ve3a1:
Sequence, based on SEQRES records: (download)
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Pyrococcus horikoshii [TaxId: 53953]}
gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
nqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvviefk
seqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk
Sequence, based on observed residues (ATOM records): (download)
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Pyrococcus horikoshii [TaxId: 53953]}
gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
nqvfkevrrvlkpsgkfimyftdlrellprlkeiskvipdqeertvviefsfrvrfnvwg
ktgvellaklyftkeaeekvgnysyltvynpk
SCOPe Domain Coordinates for d1ve3a1:
Click to download the PDB-style file with coordinates for d1ve3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ve3a1:
- d1ve3a1 first appeared in SCOP 1.73
- d1ve3a1 appears in SCOPe 2.02
- d1ve3a1 appears in SCOPe 2.04
- d1ve3a1 appears in the current release, SCOPe 2.08
View in 3D
