SCOPe 2.08: Domain d1vaxa1: 1vax A:142-297

Lineage for d1vaxa1 (1vax A:142-297)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.96: T-fold [55619] (2 superfamilies)
beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
tunnel-shaped: its known members form wide oligomeric barrels different sizes
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
bind purine or pterin in topologically similar sites between subunits
Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
automatically mapped to Pfam PF01014
Protein Urate oxidase (uricase) [55634] (3 species)
duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
Species Arthrobacter globiformis [TaxId:1665] [143630] (2 PDB entries)
Domain d1vaxa1: 1vax A:142-297 [119910]

Details for d1vaxa1

PDB Entry: 1vax (more details), 1.99 Å

PDB Description: Crystal Structure of Uricase from Arthrobacter globiformis

PDB Compounds: (A:) Uric acid oxidase

SCOPe Domain Sequences for d1vaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaxa1 d.96.1.4 (A:142-297) Urate oxidase (uricase) {Arthrobacter globiformis [TaxId: 1665]}
seqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarwryntvevdfda
vyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnkhhflvdlqpfg
qdnpnevfyaadrpyglieatiqregsradhpiwsn

SCOPe Domain Coordinates for d1vaxa1:

Click to download the PDB-style file with coordinates for d1vaxa1.
(The format of our PDB-style files is described here.)

Timeline for d1vaxa1: