Lineage for d1va9a1 (1va9 A:8-116)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521300Protein Down syndrome cell adhesion molecule-like protein 1, DSCAML1 [141055] (1 species)
  7. 1521301Species Human (Homo sapiens) [TaxId:9606] [141056] (1 PDB entry)
    Uniprot Q8TD84 979-1087
  8. 1521302Domain d1va9a1: 1va9 A:8-116 [119904]

Details for d1va9a1

PDB Entry: 1va9 (more details)

PDB Description: solution structure of the second fniii domain of dscaml1 protein
PDB Compounds: (A:) Down syndrome cell adhesion molecule like-protein 1b

SCOPe Domain Sequences for d1va9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}
isteeaapdgppmdvtlqpvtsqsiqvtwkapkkelqngvirgyqigyrenspgsngqys
ivemkatgdsevytldnlkkfaqygvvvqafnragtgpssseinattle

SCOPe Domain Coordinates for d1va9a1:

Click to download the PDB-style file with coordinates for d1va9a1.
(The format of our PDB-style files is described here.)

Timeline for d1va9a1: