Lineage for d1v89a_ (1v89 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1798840Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1799030Protein Rho-GTPase-activating protein 25 (KIAA0053) [110268] (1 species)
  7. 1799031Species Human (Homo sapiens) [TaxId:9606] [110269] (1 PDB entry)
    Uniprot P42331 40-144
  8. 1799032Domain d1v89a_: 1v89 A: [108424]
    Structural genomics target

Details for d1v89a_

PDB Entry: 1v89 (more details)

PDB Description: solution structure of the pleckstrin homology domain of human kiaa0053 protein
PDB Compounds: (A:) Hypothetical protein KIAA0053

SCOPe Domain Sequences for d1v89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgpikmgwlkkqrsivknwqqryfvlraqqlyyykdeedtkpqgcmylpgctike
iatnpeeagkfvfeiipaswdqnrmgqdsyvlmassqaemeewvkflrrvagsgpssg

SCOPe Domain Coordinates for d1v89a_:

Click to download the PDB-style file with coordinates for d1v89a_.
(The format of our PDB-style files is described here.)

Timeline for d1v89a_: