Lineage for d1v5ya1 (1v5y A:2-218)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867509Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 867510Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families) (S)
  5. 867511Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins)
  6. 867512Protein Flavin reductase P (NADPH:FMN oxidoreductase) [55473] (2 species)
  7. 867513Species Vibrio fischeri [TaxId:668] [55475] (3 PDB entries)
  8. 867516Domain d1v5ya1: 1v5y A:2-218 [119855]
    automatically matched to d1vfra_
    complexed with 4hc, fmn

Details for d1v5ya1

PDB Entry: 1v5y (more details), 1.9 Å

PDB Description: Binding of coumarins to NAD(P)H:FMN oxidoreductase
PDB Compounds: (A:) Major NAD(P)H-flavin oxidoreductase

SCOP Domain Sequences for d1v5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ya1 d.90.1.1 (A:2-218) Flavin reductase P (NADPH:FMN oxidoreductase) {Vibrio fischeri [TaxId: 668]}
thpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakqr
mhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafas
fkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadelk
gyechvalaigyhhpsedynaslpksrkafedvitil

SCOP Domain Coordinates for d1v5ya1:

Click to download the PDB-style file with coordinates for d1v5ya1.
(The format of our PDB-style files is described here.)

Timeline for d1v5ya1: