Lineage for d1v54b2 (1v54 B:1-90)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252855Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2252897Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2252898Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2252947Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2252948Species Cow (Bos taurus) [TaxId:9913] [81454] (35 PDB entries)
  8. 2252953Domain d1v54b2: 1v54 B:1-90 [100323]
    Other proteins in same PDB: d1v54a_, d1v54b1, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54b2

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOPe Domain Sequences for d1v54b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54b2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d1v54b2:

Click to download the PDB-style file with coordinates for d1v54b2.
(The format of our PDB-style files is described here.)

Timeline for d1v54b2: