Lineage for d1v1qa_ (1v1q A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) 
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
barrel, closed; n=5, S=10
Protein Primosomal replication protein N, PriB [117191] (1 species) Species Escherichia coli [TaxId:562] [117192] (2 PDB entries)
Uniprot P07013
Domain d1v1qa_: 1v1q A: [113490]
complexed with cys
Details for d1v1qa_
PDB Entry: 1v1q (more details), 2.1 Å
PDB Description: crystal structure of prib- a primosomal dna replication protein of escherichia coli
PDB Compounds: (A:) primosomal replication protein nSCOPe Domain Sequences for d1v1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
pnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsg
henqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvdkla
SCOPe Domain Coordinates for d1v1qa_:
Click to download the PDB-style file with coordinates for d1v1qa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v1qa_:
- d1v1qa_ first appeared in SCOP 1.71
- d1v1qa_ appears in SCOPe 2.04
- d1v1qa_ is called d1v1qa1 in SCOPe 2.06
- d1v1qa_ appears in the current release, SCOPe 2.08, called d1v1qa1
View in 3D
