Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein Primosomal replication protein N, PriB [117191] (1 species) |
Species Escherichia coli [TaxId:562] [117192] (2 PDB entries) Uniprot P07013 |
Domain d1v1qa_: 1v1q A: [113490] complexed with cys |
PDB Entry: 1v1q (more details), 2.1 Å
SCOPe Domain Sequences for d1v1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} pnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsg henqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvdkla
Timeline for d1v1qa_: