Lineage for d1v05a_ (1v05 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375706Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2375750Protein Filamin C [117049] (1 species)
  7. 2375751Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries)
    Uniprot Q14315 2633-2725
  8. 2375752Domain d1v05a_: 1v05 A: [113465]
    24th, C-terminal repeat

Details for d1v05a_

PDB Entry: 1v05 (more details), 1.43 Å

PDB Description: dimerization of human filamin c: crystal structure of the domain 24
PDB Compounds: (A:) filamin c

SCOPe Domain Sequences for d1v05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
amgsdaskvvtrgpglsqafvgqknsftvdcskagtnmmmvgvhgpktpceevyvkhmgn
rvynvtytvkekgdyilivkwgdesvpgspfkvkvp

SCOPe Domain Coordinates for d1v05a_:

Click to download the PDB-style file with coordinates for d1v05a_.
(The format of our PDB-style files is described here.)

Timeline for d1v05a_: