Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
Protein Filamin C [117049] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries) Uniprot Q14315 2633-2725 |
Domain d1v05a_: 1v05 A: [113465] 24th, C-terminal repeat |
PDB Entry: 1v05 (more details), 1.43 Å
SCOPe Domain Sequences for d1v05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} amgsdaskvvtrgpglsqafvgqknsftvdcskagtnmmmvgvhgpktpceevyvkhmgn rvynvtytvkekgdyilivkwgdesvpgspfkvkvp
Timeline for d1v05a_: