Lineage for d1urka2 (1urk A:50-135)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703146Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1703147Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 1703148Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1703237Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 1703238Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries)
  8. 1703251Domain d1urka2: 1urk A:50-135 [44659]
    Other proteins in same PDB: d1urka1
    complexed with fuc

Details for d1urka2

PDB Entry: 1urk (more details)

PDB Description: solution structure of the amino terminal fragment of urokinase-type plasminogen activator
PDB Compounds: (A:) plasminogen activator

SCOPe Domain Sequences for d1urka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urka2 g.14.1.1 (A:50-135) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdcadgk

SCOPe Domain Coordinates for d1urka2:

Click to download the PDB-style file with coordinates for d1urka2.
(The format of our PDB-style files is described here.)

Timeline for d1urka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1urka1