Lineage for d1ur6a_ (1ur6 A:)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (4 families) 
Family d.20.1.1: UBC-related [54496] (6 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) 
Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (8 PDB entries)
E2-17 kDa 2
Domain d1ur6a_: 1ur6 A: [99811]
Other proteins in same PDB: d1ur6b_
complexed with zn
Details for d1ur6a_
PDB Entry: 1ur6 (more details)
PDB Description: nmr based structural model of the ubch5b-cnot4 complex
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-17 kda 2SCOP Domain Sequences for d1ur6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ur6a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam
SCOP Domain Coordinates for d1ur6a_:
Click to download the PDB-style file with coordinates for d1ur6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ur6a_:
- d1ur6a_ first appeared in SCOP 1.67
- d1ur6a_ appears in SCOP 1.71
- d1ur6a_ appears in SCOP 1.75
- d1ur6a_ appears in the current release, SCOPe 2.08
View in 3D
