Lineage for d1ur0b_ (1ur0 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Beta-1,4-galactanase [89469] (4 species) 
Species Bacillus licheniformis [TaxId:1402] [117367] (4 PDB entries)
Uniprot Q65CX5 36-422 ! Uniprot Q65CX5 28-424
Domain d1ur0b_: 1ur0 B: [113401]
complexed with ca, pge
Details for d1ur0b_
PDB Entry: 1ur0 (more details), 2.5 Å
PDB Description: the structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.
PDB Compounds: (B:) galactanaseSCOPe Domain Sequences for d1ur0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ur0b_ c.1.8.3 (B:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtpfk
SCOPe Domain Coordinates for d1ur0b_:
Click to download the PDB-style file with coordinates for d1ur0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ur0b_:
- d1ur0b_ first appeared in SCOP 1.71
- d1ur0b_ appears in SCOPe 2.07
View in 3D
