Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Phosphoinositol 3-phosphate binding protein-1, PEPP1 [117244] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117245] (2 PDB entries) Uniprot Q9H4M7 47-153 |
Domain d1upqa_: 1upq A: [113392] complexed with so4 |
PDB Entry: 1upq (more details), 1.48 Å
SCOPe Domain Sequences for d1upqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} lrrdpnlpvhirgwlhkqdssglrlwkrrwfvlsghclfyykdsreesvlgsvllpsyni rpdgpgaprgrrftftaehpgmrtyvlaadtledlrgwlralgrasr
Timeline for d1upqa_: