Lineage for d1uoka2 (1uok A:1-479)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Oligo-1,6, glucosidase [51476] (1 species) Species Bacillus cereus [TaxId:1396] [51477] (1 PDB entry) 
Domain d1uoka2: 1uok A:1-479 [28788]
Other proteins in same PDB: d1uoka1
Details for d1uoka2
PDB Entry: 1uok (more details), 2 Å
PDB Description: crystal structure of b. cereus oligo-1,6-glucosidase
PDB Compounds: (A:) oligo-1,6-glucosidaseSCOPe Domain Sequences for d1uoka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]}
mekqwwkesvvyqiyprsfmdsngdgigdlrgiiskldylkelgidviwlspvyespndd
ngydisdyckimnefgtmedwdellhemhernmklmmdlvvnhtsdehnwfiesrkskdn
kyrdyyiwrpgkegkepnnwgaafsgsawqydemtdeyylhlfskkqpdlnwdnekvrqd
vyemmkfwlekgidgfrmdvinfiskeeglptveteeegyvsghkhfmngpnihkylhem
neevlshydimtvgempgvtteeaklytgeerkelqmvfqfehmdldsgeggkwdvkpcs
lltlkenltkwqkalehtgwnslywnnhdqprvvsrfgndgmyriesakmlatvlhmmkg
tpyiyqgeeigmtnvrfesideyrdietlnmykekvmergediekvmqsiyikgrdnart
pmqwddqnhagfttgepwitvnpnykeinvkqaiqnkdsifyyykklielrknneivvy
SCOPe Domain Coordinates for d1uoka2:
Click to download the PDB-style file with coordinates for d1uoka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uoka2:
- d1uoka2 first appeared (with stable ids) in SCOP 1.55, called d1uok_2
- d1uoka2 appears in SCOPe 2.04
- d1uoka2 appears in SCOPe 2.06
- d1uoka2 appears in the current release, SCOPe 2.08
View in 3D
