Lineage for d1umzb_ (1umz B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
Pfam PF00722
beta-Glucanase-like
Protein Xyloglucan endotransglycosylase [101634] (1 species) Species European aspen (Populus tremula) [TaxId:113636] [101635] (2 PDB entries) 
Domain d1umzb_: 1umz B: [99640]
Details for d1umzb_
PDB Entry: 1umz (more details), 1.8 Å
PDB Description: xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide xllg.
PDB Compounds: (B:) xyloglucan endotransglycosylaseSCOPe Domain Sequences for d1umzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umzb_ b.29.1.2 (B:) Xyloglucan endotransglycosylase {European aspen (Populus tremula) [TaxId: 113636]}
vafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpgdsa
gtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptkefh
yysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrgglekt
dwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrqkyt
iynyctdrsrypsmppeckrdrdi
SCOPe Domain Coordinates for d1umzb_:
Click to download the PDB-style file with coordinates for d1umzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1umzb_:
- d1umzb_ first appeared in SCOP 1.67
- d1umzb_ appears in SCOPe 2.04
- d1umzb_ appears in SCOPe 2.06
- d1umzb_ appears in the current release, SCOPe 2.08
View in 3D
