Lineage for d1ul9a_ (1ul9 A:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) 
Protein Galectin-2 [101639] (1 species) Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries) 
Domain d1ul9a_: 1ul9 A: [99541]
Details for d1ul9a_
PDB Entry: 1ul9 (more details), 2.22 Å
PDB Description: CGL2 ligandfree
PDB Compounds: (A:) galectin-2SCOPe Domain Sequences for d1ul9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ul9a_ b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa
SCOPe Domain Coordinates for d1ul9a_:
Click to download the PDB-style file with coordinates for d1ul9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ul9a_:
- d1ul9a_ first appeared in SCOP 1.67
- d1ul9a_ appears in SCOPe 2.01
- d1ul9a_ appears in SCOPe 2.03
- d1ul9a_ appears in the current release, SCOPe 2.08
View in 3D
