Lineage for d1ukwa2 (1ukw A:32-258)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451319Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 1451361Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. 1451392Species Thermus thermophilus [TaxId:274] [118186] (1 PDB entry)
    Uniprot Q5SJ70 32-409
  8. 1451393Domain d1ukwa2: 1ukw A:32-258 [113264]
    Other proteins in same PDB: d1ukwa1, d1ukwb1
    complexed with co, fad

Details for d1ukwa2

PDB Entry: 1ukw (more details), 2.4 Å

PDB Description: Crystal structure of medium-chain acyl-CoA dehydrogenase from Thermus thermophilus HB8
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d1ukwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]}
idfslteeqrqlqalarrfakevilpvaqeydekeevpwpvieklhevgllnaiipeeyg
gmglkmldevivgeelayacmgiytipmasdlgitpvllagteeqkerflrpltekpala
afalsepgngsdaaalktrairqgdhyvlngtkmwisnggeaewvvvfatvnpelrhkgv
valvvergtpgfkaikihgkmgqrasgtyelvfedvkvpvenrlgee

SCOPe Domain Coordinates for d1ukwa2:

Click to download the PDB-style file with coordinates for d1ukwa2.
(The format of our PDB-style files is described here.)

Timeline for d1ukwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ukwa1