Lineage for d1uk0a2 (1uk0 A:138-350)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877625Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 877626Superfamily d.166.1: ADP-ribosylation [56399] (7 families) (S)
  5. 877774Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein)
  6. 877775Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 877784Species Human (Homo sapiens) [TaxId:9606] [103339] (5 PDB entries)
    Uniprot P09874 661-1010
  8. 877793Domain d1uk0a2: 1uk0 A:138-350 [99478]
    Other proteins in same PDB: d1uk0a1, d1uk0b1

Details for d1uk0a2

PDB Entry: 1uk0 (more details), 3 Å

PDB Description: Crystal structure of catalytic domain of human poly(ADP-ribose) polymerase with a novel inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase-1

SCOP Domain Sequences for d1uk0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk0a2 d.166.1.2 (A:138-350) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhnrr
llwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpigl
illgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg
vndtsllyneyivydiaqvnlkyllklkfnfkt

SCOP Domain Coordinates for d1uk0a2:

Click to download the PDB-style file with coordinates for d1uk0a2.
(The format of our PDB-style files is described here.)

Timeline for d1uk0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uk0a1