Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries) Uniprot P13726 33-242 |
Domain d1uj3c2: 1uj3 C:707-810 [107893] Other proteins in same PDB: d1uj3a1, d1uj3a2, d1uj3b1, d1uj3b2 |
PDB Entry: 1uj3 (more details), 2.1 Å
SCOPe Domain Sequences for d1uj3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uj3c2 b.1.2.1 (C:707-810) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
Timeline for d1uj3c2:
View in 3D Domains from other chains: (mouse over for more information) d1uj3a1, d1uj3a2, d1uj3b1, d1uj3b2 |