Lineage for d1ugia_ (1ugi A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species)
  7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries)
  8. Domain d1ugia_: 1ugi A: [38125]
    complexed with imd, so4

Details for d1ugia_

PDB Entry: 1ugi (more details), 1.55 Å

PDB Description: uracil-dna glycosylase inhibitor protein
PDB Compounds: (A:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d1ugia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugia_ d.17.5.1 (A:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

SCOPe Domain Coordinates for d1ugia_ are not available.

Timeline for d1ugia_:

Domains from other chains:
(mouse over for more information)
d1ugib_, d1ugic_, d1ugid_, d1ugie_, d1ugif_, d1ugig_, d1ugih_