| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (1 protein) |
| Protein Dissimilatory sulfite reductase DsvD [101049] (1 species) |
| Species Desulfovibrio vulgaris [TaxId:881] [101050] (2 PDB entries) |
| Domain d1ucrb_: 1ucr B: [99189] complexed with so4 |
PDB Entry: 1ucr (more details), 1.2 Å
SCOP Domain Sequences for d1ucrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ucrb_ a.4.5.45 (B:) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagkqaaae
Timeline for d1ucrb_: