Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins) automatically mapped to Pfam PF01088 |
Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54052] (2 PDB entries) Uniprot P15374 |
Domain d1ucha_: 1uch A: [37129] |
PDB Entry: 1uch (more details), 1.8 Å
SCOPe Domain Sequences for d1ucha_:
Sequence, based on SEQRES records: (download)
>d1ucha_ d.3.1.6 (A:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens) [TaxId: 9606]} rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle esvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyeld grkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa
>d1ucha_ d.3.1.6 (A:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens) [TaxId: 9606]} rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle esvsmspeerarylenydairvdlhfialvhvdghlyeldgrkpfpinhgetsdetlled aievckkfmerdpdelrfnaialsaa
Timeline for d1ucha_: