Lineage for d1ucha_ (1uch A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634603Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins)
    automatically mapped to Pfam PF01088
  6. 1634612Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species)
  7. 1634613Species Human (Homo sapiens) [TaxId:9606] [54052] (2 PDB entries)
    Uniprot P15374
  8. 1634616Domain d1ucha_: 1uch A: [37129]

Details for d1ucha_

PDB Entry: 1uch (more details), 1.8 Å

PDB Description: deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom resolution
PDB Compounds: (A:) ubiquitin c-terminal hydrolase uch-l3

SCOPe Domain Sequences for d1ucha_:

Sequence, based on SEQRES records: (download)

>d1ucha_ d.3.1.6 (A:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens) [TaxId: 9606]}
rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev
frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle
esvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyeld
grkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa

Sequence, based on observed residues (ATOM records): (download)

>d1ucha_ d.3.1.6 (A:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens) [TaxId: 9606]}
rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev
frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle
esvsmspeerarylenydairvdlhfialvhvdghlyeldgrkpfpinhgetsdetlled
aievckkfmerdpdelrfnaialsaa

SCOPe Domain Coordinates for d1ucha_:

Click to download the PDB-style file with coordinates for d1ucha_.
(The format of our PDB-style files is described here.)

Timeline for d1ucha_: