Lineage for d1uasa2 (1uas A:1-273)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Melibiase [75064] (4 species) Species Rice (Oryza sativa) [TaxId:4530] [89468] (1 PDB entry)
alpha-galactosidase
Domain d1uasa2: 1uas A:1-273 [88389]
Other proteins in same PDB: d1uasa1
complexed with gla, gol, pt, so4
missing some secondary structures that made up less than one-third of the common domain
Details for d1uasa2
PDB Entry: 1uas (more details), 1.5 Å
PDB Description: crystal structure of rice alpha-galactosidase
PDB Compounds: (A:) alpha-galactosidaseSCOPe Domain Sequences for d1uasa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uasa2 c.1.8.1 (A:1-273) Melibiase {Rice (Oryza sativa) [TaxId: 4530]}
fenglgrtpqmgwnswnhfycgineqiiretadalvntglaklgyqyvniddcwaeysrd
sqgnfvpnrqtfpsgikaladyvhakglklgiysdagsqtcsnkmpgsldheeqdvktfa
swgvdylkydncndagrsvmerytrmsnamktygkniffslcewgkenpatwagrmgnsw
rttgdiadnwgsmtsradendqwaayagpggwndpdmlevgnggmseaeyrshfsiwala
kaplligcdvrsmsqqtknilsnseviavnqds
SCOPe Domain Coordinates for d1uasa2:
Click to download the PDB-style file with coordinates for d1uasa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uasa2:
- d1uasa2 first appeared in SCOP 1.65
- d1uasa2 appears in SCOPe 2.07
View in 3D
